hGUHO08446

DGRC Stock Number: 1665663

RRID: RRID:DGRC_1665663

Donor: BDGP

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $52.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO08446

When publishing experiments using hGUHO08446, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO08446 (DGRC Stock 1665663 ; https://dgrc.bio.indiana.edu//stock/1665663 ; RRID:DGRC_1665663)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene LAMP5   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG32225 LAMP5 8 Yes Yes
Base Vector pGW-HA.attB
AA Size 358
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGATCTCCAAGGAAGAGGGGTCCCCAGCATCGACAGACTTCGAGTTCTCCTGATGTTGTTCCATACAATGGCTCAAATCATGGCAGAACAAGAAGTGGAAAATCTCTCAGGCCTTTCCACTAACCCTGAAAAAGATATATTTGTGGTGCGGGAAAATGGGACGACGTGTCTCATGGCAGAGTTTGCAGCCAAATTTATTGTACCTTATGATGTGTGGGCCAGCAACTACGTAGATCTGATCACAGAACAGGCCGATATCGCATTGACCCGGGGAGCTGAGGTGAAGGGCCGCTGTGGCCACAGCCAGTCGGAGCTGCAAGTGTTCTGGGTGGATCGCGCATATGCACTCAAAATGCTCTTTGTAAAGGAAAGCCACAACATGTCCAAGGGACCTGAGGCGACTTGGAGGCTGAGCAAAGTGCAGTTTGTCTACGACTCCTCGGAGAAAACCCACTTCAAAGACGCAGTCAGTGCTGGGAAGCACACAGCCAACTCGCACCACCTCTCTGCCTTGGTCACCCCCGCTGGGAAGTCCTATGAGTGTCAAGCTCAACAAACCATTTCACTGGCCTCTAGTGATCCGCAGAAGACGGTCACCATGATCCTGTCTGCGGTCCACATCCAACCTTTTGACATTATCTCAGATTTTGTCTTCAGTGAAGAGCATAAATGCCCAGTGGATGAGCGGGAGCAACTGGAAGAAACCTTGCCCCTGATTTTGGGGCTCATCTTGGGCCTCGTCATCATGGTAACACTCGCGATTTACCACGTCCACCACAAAATGACTGCCAACCAGGTGCAGATCCCTCGGGACAGATCCCAGTATAAGCACATGGGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMGYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCATGGATCTCCAAGGAAGAGGGGTCCCCAGCATCGACAGACTTCGAGTTCTCCTGATGTTGTTCCATACAATGGCTCAAATCATGGCAGAACAAGAAGTGGAAAATCTCTCAGGCCTTTCCACTAACCCTGAAAAAGATATATTTGTGGTGCGGGAAAATGGGACGACGTGTCTCATGGCAGAGTTTGCAGCCAAATTTATTGTACCTTATGATGTGTGGGCCAGCAACTACGTAGATCTGATCACAGAACAGGCCGATATCGCATTGACCCGGGGAGCTGAGGTGAAGGGCCGCTGTGGCCACAGCCAGTCGGAGCTGCAAGTGTTCTGGGTGGATCGCGCATATGCACTCAAAATGCTCTTTGTAAAGGAAAGCCACAACATGTCCAAGGGACCTGAGGCGACTTGGAGGCTGAGCAAAGTGCAGTTTGTCTACGACTCCTCGGAGAAAACCCACTTCAAAGACGCAGTCAGTGCTGGGAAGCACACAGCCAACTCGCACCACCTCTCTGCCTTGGTCACCCCCGCTGGGAAGTCCTATGAGTGTCAAGCTCAACAAACCATTTCACTGGCCTCTAGTGATCCGCAGAAGACGGTCACCATGATCCTGTCTGCGGTCCACATCCAACCTTTTGACATTATCTCAGATTTTGTCTTCAGTGAAGAGCATAAATGCCCAGTGGATGAGCGGGAGCAACTGGAAGAAACCTTGCCCCTGATTTTGGGGCTCATCTTGGGCCTCGTCATCATGGTAACACTCGCGATTTACCACGTCCACCACAAAATGACTGCCAACCAGGTGCAGATCCCTCGGGACAGATCCCAGTATAAGCACATGGGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCTATTCTCCTACTTAGTATAGGAACTTCCATCCTTGGGAGCTCCTTCAGAAGGCGGGTGCTACTGGCTGGCGCTGGTGGAGCCGGTGAACCTGCGGGGTAATTAACCATACGATGTTTCTGAAATATGGCGGGGCTATCCTATAGAACGT
Sequenced 3' End TCAAGCGTAATCTGGAACGTCATATGGATAGGATCCTGCATAGTCCGGGACGTCATAGGGATAGCCCGCATAGTCAGGAACATCGTATGGGTAAATTAACCCCGCAGGTCCACCGGCTCCACCAGCGCCAGCAGTAGCACCGCCTCCTGAAGGAGCTCCAAGGATG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.34|A|6 Available