hGUHO08446

DGRC Stock Number: 1665663

RRID: RRID:DGRC_1665663

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO08446

When publishing experiments using hGUHO08446, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO08446 (DGRC Stock 1665663 ; https://dgrc.bio.indiana.edu//stock/1665663 ; RRID:DGRC_1665663)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene LAMP5   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG32225 LAMP5 8 Yes Yes
Base Vector pGW-HA.attB
AA Size 358
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGATCTCCAAGGAAGAGGGGTCCCCAGCATCGACAGACTTCGAGTTCTCCTGATGTTGTTCCATACAATGGCTCAAATCATGGCAGAACAAGAAGTGGAAAATCTCTCAGGCCTTTCCACTAACCCTGAAAAAGATATATTTGTGGTGCGGGAAAATGGGACGACGTGTCTCATGGCAGAGTTTGCAGCCAAATTTATTGTACCTTATGATGTGTGGGCCAGCAACTACGTAGATCTGATCACAGAACAGGCCGATATCGCATTGACCCGGGGAGCTGAGGTGAAGGGCCGCTGTGGCCACAGCCAGTCGGAGCTGCAAGTGTTCTGGGTGGATCGCGCATATGCACTCAAAATGCTCTTTGTAAAGGAAAGCCACAACATGTCCAAGGGACCTGAGGCGACTTGGAGGCTGAGCAAAGTGCAGTTTGTCTACGACTCCTCGGAGAAAACCCACTTCAAAGACGCAGTCAGTGCTGGGAAGCACACAGCCAACTCGCACCACCTCTCTGCCTTGGTCACCCCCGCTGGGAAGTCCTATGAGTGTCAAGCTCAACAAACCATTTCACTGGCCTCTAGTGATCCGCAGAAGACGGTCACCATGATCCTGTCTGCGGTCCACATCCAACCTTTTGACATTATCTCAGATTTTGTCTTCAGTGAAGAGCATAAATGCCCAGTGGATGAGCGGGAGCAACTGGAAGAAACCTTGCCCCTGATTTTGGGGCTCATCTTGGGCCTCGTCATCATGGTAACACTCGCGATTTACCACGTCCACCACAAAATGACTGCCAACCAGGTGCAGATCCCTCGGGACAGATCCCAGTATAAGCACATGGGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMGYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCATGGATCTCCAAGGAAGAGGGGTCCCCAGCATCGACAGACTTCGAGTTCTCCTGATGTTGTTCCATACAATGGCTCAAATCATGGCAGAACAAGAAGTGGAAAATCTCTCAGGCCTTTCCACTAACCCTGAAAAAGATATATTTGTGGTGCGGGAAAATGGGACGACGTGTCTCATGGCAGAGTTTGCAGCCAAATTTATTGTACCTTATGATGTGTGGGCCAGCAACTACGTAGATCTGATCACAGAACAGGCCGATATCGCATTGACCCGGGGAGCTGAGGTGAAGGGCCGCTGTGGCCACAGCCAGTCGGAGCTGCAAGTGTTCTGGGTGGATCGCGCATATGCACTCAAAATGCTCTTTGTAAAGGAAAGCCACAACATGTCCAAGGGACCTGAGGCGACTTGGAGGCTGAGCAAAGTGCAGTTTGTCTACGACTCCTCGGAGAAAACCCACTTCAAAGACGCAGTCAGTGCTGGGAAGCACACAGCCAACTCGCACCACCTCTCTGCCTTGGTCACCCCCGCTGGGAAGTCCTATGAGTGTCAAGCTCAACAAACCATTTCACTGGCCTCTAGTGATCCGCAGAAGACGGTCACCATGATCCTGTCTGCGGTCCACATCCAACCTTTTGACATTATCTCAGATTTTGTCTTCAGTGAAGAGCATAAATGCCCAGTGGATGAGCGGGAGCAACTGGAAGAAACCTTGCCCCTGATTTTGGGGCTCATCTTGGGCCTCGTCATCATGGTAACACTCGCGATTTACCACGTCCACCACAAAATGACTGCCAACCAGGTGCAGATCCCTCGGGACAGATCCCAGTATAAGCACATGGGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCTATTCTCCTACTTAGTATAGGAACTTCCATCCTTGGGAGCTCCTTCAGAAGGCGGGTGCTACTGGCTGGCGCTGGTGGAGCCGGTGAACCTGCGGGGTAATTAACCATACGATGTTTCTGAAATATGGCGGGGCTATCCTATAGAACGT
Sequenced 3' End TCAAGCGTAATCTGGAACGTCATATGGATAGGATCCTGCATAGTCCGGGACGTCATAGGGATAGCCCGCATAGTCAGGAACATCGTATGGGTAAATTAACCCCGCAGGTCCACCGGCTCCACCAGCGCCAGCAGTAGCACCGCCTCCTGAAGGAGCTCCAAGGATG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.34|A|6 Available