hGUHO04010

DGRC Stock Number: 1662268

RRID: RRID:DGRC_1662268

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO04010

When publishing experiments using hGUHO04010, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO04010 (DGRC Stock 1662268 ; https://dgrc.bio.indiana.edu//stock/1662268 ; RRID:DGRC_1662268)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene SH2B1   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
Lnk SH2B1 10 No Yes
Base Vector pGW-HA.attB
AA Size 427
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGTGCAGAGGGAAGAGCTGCTGAGTTTCATGGGGGCTGAGGAGGCAGCCCCTGACCCAGCCGGAGTGGGCCGGGGAGGAGGGGTGGCTGGGCCTCCTTCAGGGGGAGGAGGGCAGCCTCAGTGGCAGAAGTGTCGCCTGCTGCTTCGAAGTGAAGGAGAAGGAGGAGGAGGAAGTCGCCTGGAGTTCTTTGTACCACCCAAGGCCTCTCGGCCCCGACTCAGCATCCCCTGCTCTTCTATCACAGACGTCCGGACAACCACAGCCCTGGAGATGCCTGACCGGGAGAACACGTTTGTGGTTAAGGTGGAAGGTCCATCCGAGTATATCATGGAGACAGTGGATGCCCAGCATGTGAAGGCCTGGGTGTCTGACATCCAAGAATGCCTGAGCCCAGGACCCTGCCCTGCTACCAGTCCCCGCCCCATGACCCTCCCTCTGGCCCCTGGGACCTCATTCCTTACAAGGGAGAACACAGACAGCCTGGAGCTGTCCTGCCTGAATCACTCGGAGAGTCTACCCAGCCAGGACCTGCTGCTTGGACCCAGCGAGAGCAATGACCGCCTGTCGCAGGGGGCATATGGGGGCCTCTCAGACCGCCCCTCGGCATCCATCTCCCCCAGCTCTGCCTCCATTGCCGCCTCCCATTTTGACTCGATGGAACTGCTTCCCCCAGAGTTGCCCCCCCGCATCCCCATTGAAGAGGGACCCCCAGCAGGGACAGTTCATCCCCTCTCAGCCCCCTACCCTCCCTTGGACACTCCGGAAACAGCCACAGGGTCCTTCCTGTTCCAGGGGGAGCCAGAGGGCGGTGAGGGGGACCAGCCCCTCTCAGGGTATCCTTGGTTCCACGGGATGCTCTCTCGGCTCAAGGCTGCACAGTTGGCGCTGACTGGCGGCACTGGCTCCCACGGTGTCTTCCTGGTGCGCCAGAGTGAGACAAGGCGGGGTGAATACGTCCTCACCTTCAACTTCCAGGGCAAGGCCAAGCACCTGCGTTTGTCGCTGAACGAGGAGGGTCAGTGCCGGGTCCAGCACCTGTGGTTCCAGTCCATTTTCGATATGCTCGAGCACTTCCGGGTGCACCCCATCCCTTTGGAGTCGGGAGGCTCCAGTGATGTTGTCCTTGTCAGCTATGTCCCATCCTCCCAGCGACAGCAGGGCCGGGAGCAGGCTGGGAGCCATGCGGGGGTGTGCGAGGGAGATGGATGCCACCCCGATGCCTCCTGCACCCTCATGCCCTTCGGAGCGAGTGACTGTGTAACCGACCACCTCCCATGACCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP*
Sequenced 5' End TTGGCATGGTGCAGAGGGAAGAGCTGCTGAGTTTCATGGGGGCTGAGGAGGCAGCCCCTGACCCAGCCGGAGTGGGCCGGGGAGGAGGGGTGGCTGGGCCTCCTTCAGGGGGAGGAGGGCAGCCTCAGTGGCAGAAGTGTCGCCTGCTGCTTCGAAGTGAAGGAGAAGGAGGAGGAGGAAGTCGCCTGGAGTTCTTTGTACCACCCAAGGCCTCTCGGCCCCGACTCAGCATCCCCTGCTCTTCTATCACAGACGTCCGGACAACCACAGCCCTGGAGATGCCTGACCGGGAGAACACGTTTGTGGTTAAGGTGGAAGGTCCATCCGAGTATATCATGGAGACAGTGGATGCCCAGCATGTGAAGGCCTGGGTGTCTGACATCCAAGAATGCCTGAGCCCAGGACCCTGCCCTGCTACCAGTCCCCGCCCCATGACCCTCCCTCTGGCCCCTGGGACCTCATTCCTTACAAGGGAGAACACAGACAGCCTGGAGCTGTCCTGCCTGAATCACTCGGAGAGTCTACCCAGCCAGGACCTGCTGCTTGGACCCAGCGAGAGCAATGACCGCCTGTCGCAGGGGGCATATGGGGGCCTCTCAGACCGCCCCTCGGCATCCATCTCCCCCAGCTCTGCCTCCATTGCCGCCTCCCATTTTGACTCGATGGAACTGCTTCCCCCAGAGTTGCCCCCCCGCATCCCCATTGAAGAGGGACCCCCAGCAGGACAGTTCATCCCCTCTCAGCCCCCTACCCTCCCTTGGACACTCCGGAAACAGCCACAGGGTCCTTCCTGTTCCAGGGGAGCCAGAAAGCC
Sequenced 3' End TCAAGCGTAATCTGGAACGTCATATGGATAGGATCCTGCATAGTCCGGGACGTCATAGGGATAGCCCGCATAGTCAGGAACATCGTATGGGTAAATTAACCCCGCAGGTCCACCGGCTCCACCAGCGCCAGCAGTAGCACCGCCTCCTGAAGGAGCTCCAAGGATG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.22|C|4 Available