hGUHO02833

DGRC Stock Number: 1662086

RRID: RRID:DGRC_1662086

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO02833

When publishing experiments using hGUHO02833, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO02833 (DGRC Stock 1662086 ; https://dgrc.bio.indiana.edu//stock/1662086 ; RRID:DGRC_1662086)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene TMEM30A   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG9947 TMEM30A 13 Yes Yes
Base Vector pGW-HA.attB
AA Size 403
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTCGGCATGGCGATGAACTATAACGCGAAGGATGAAGTGGACGGTGGGCCCCCGTGTGCTCCGGGGGGCACCGCGAAGACTCGGAGACCGGATAACACGGCCTTCAAACAGCAACGGCTGCCAGCTTGGCAGCCCATCCTTACGGCTGGCACGGTGCTACCTATTTTCTTCATCATCGGTCTCATCTTCATTCCCATCGGCATTGGCATTTTTGTCACCTCCAACAACATCCGCGAGATCGAGGGCAACGTGTTTATGTATTATGGACTGTCTAATTTCTATCAAAACCATCGTCGTTACGTGAAATCTCGAGATGATAGTCAACTAAATGGAGATTCTAGTGCTTTGCTTAATCCCAGTAAGGAATGTGAACCTTATCGAAGAAATGAAGACAAACCAATTGCTCCTTGTGGAGCTATTGCCAACAGCATGTTTAATGATACATTAGAATTGTTTCTCATTGGCAATGATTCTTATCCTATACCTATCGCTTTGAAAAAGAAAGGTATTGCTTGGTGGACAGATAAAAATGTGAAATTCAGAAATCCCCCTGGAGGAGACAACCTGGAAGAACGATTTAAAGGTACAACAAAGCCTGTGAACTGGCTTAAACCAGTTTACATGCTGGATTCTGACCCAGATAATAATGGATTCATAAATGAGGATTTTATTGTTTGGATGCGTACTGCAGCATTACCTACTTTTCGCAAGTTGTATCGTCTTATAGAAAGGAAAAGTGATTTACATCCAACATTACCAGCTGGCCGATACTCTTTGAATGTCACATACAATTACCCTGTACATTATTTTGATGGACGAAAACGGATGATCTTGAGCACTATTTCATGGATGGGAGGAAAAAATCCATTTTTGGGGATTGCTTACATCGCTGTTGGATCCATCTCCTTCCTTCTGGGAGTTGTACTGCTAGTAATTAATCATAAATATAGAAACAGTAGTAATACAGCTGACATTACCATTTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITIYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.20|D|2 Available