hGUHO01394

DGRC Stock Number: 1662082

RRID: RRID:DGRC_1662082

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO01394

When publishing experiments using hGUHO01394, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO01394 (DGRC Stock 1662082 ; https://dgrc.bio.indiana.edu//stock/1662082 ; RRID:DGRC_1662082)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene TMEM50B   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG15012 TMEM50B 13 No Yes
Base Vector pGW-HA.attB
AA Size 221
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGCAGGCTTCCTAGATAATTTTCGTTGGCCAGAATGTGAATGTATTGACTGGAGTGAGAGAAGAAATGCTGTGGCATCTGTTGTCGCAGGTATATTGTTTTTTACAGGCTGGTGGATAATGATTGATGCAGCTGTGGTGTATCCTAAGCCAGAACAGTTGAACCATGCCTTTCACACATGTGGTGTATTTTCCACATTGGCTTTCTTCATGATAAATGCTGTATCCAATGCTCAGGTGAGAGGTGATAGCTATGAAAGCGGCTGTTTAGGAAGAACAGGTGCTCGAGTTTGGCTTTTCATTGGTTTCATGTTGATGTTTGGGTCACTTATTGCTTCCATGTGGATTCTTTTTGGTGCATATGTTACCCAAAATACTGATGTTTATCCGGGACTAGCTGTGTTTTTTCAAAATGCACTTATATTTTTTAGCACTCTGATCTACAAATTTGGAAGAACCGAAGAGCTATGGACCTGCCCAACTTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGGCGGACACCGGTCCACGTGA
AA Sequence MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWTCPTFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAHGGHRST*
Sequenced 3' End ACCACTTTGTACAAGAAAGTTGGGCAGGTCCATAGCTCTTCGGTTCTTCCAAATTTGTAGATCAGAGTGCTAAAAAATATATGTGCATTTTGAAAAAACACAGCTAGTCCCGGATAAACATC
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.20|C|10 Available