hGUHO01232

DGRC Stock Number: 1662074

RRID: RRID:DGRC_1662074

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO01232

When publishing experiments using hGUHO01232, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO01232 (DGRC Stock 1662074 ; https://dgrc.bio.indiana.edu//stock/1662074 ; RRID:DGRC_1662074)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene CHCHD10   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG5010 CHCHD10 11 No Yes
CG31007 CHCHD10 8 Yes No
Base Vector pGW-HA.attB
AA Size 205
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCACCATGCCTCGGGGAAGCCGCAGCGCGGCCTCCCGGCCAGCCAGCCGCCCAGCCGCGCCCTCTGCCCACCCGCCCGCGCACCCACCGCCCTCGGCAGCCGCCCCAGCCCCCGCCCCTTCGGGCCAGCCGGGGCTCATGGCTCAGATGGCGACCACGGCCGCAGGGGTAGCCGTGGGCTCGGCTGTGGGACACGTCATGGGCAGCGCCCTGACCGGAGCCTTCAGCGGGGGGAGCTCGGAGCCCTCCCAGCCTGCTGTCCAGCAGGCCCCCACCCCCGCTGCCCCCCAGCCCCTGCAGATGGGGCCCTGCGCCTACGAGATCAGGCAGTTCCTGGACTGTTCCACCACTCAGAGTGACCTGTCCCTGTGTGAGGGCTTCAGCGAGGCCCTGAAGCAGTGCAAGTACTACCATGGTCTGAGCTCCCTGCCCTTGCCAACTTTCTTGTACAAAGTGGTGAGCTCCGCCACCATGGATCTCCACCGCGGTGGAGGCCGCATCTTTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTGCTCATGGCGGACACCGGTCCACGTGA
AA Sequence MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLPLPTFLYKVVSSATMDLHRGGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAHGGHRST*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.20|C|2 Available