hGUHO03625

DGRC Stock Number: 1662043

RRID: RRID:DGRC_1662043

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03625

When publishing experiments using hGUHO03625, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03625 (DGRC Stock 1662043 ; https://dgrc.bio.indiana.edu//stock/1662043 ; RRID:DGRC_1662043)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene SGCA   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
Scgalpha SGCA 11 No Yes
Base Vector pGW-HA.attB
AA Size 465
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGCTGAGACACTCTTCTGGACTCCTCTCCTCGTGGTTCTCCTGGCAGGGCTGGGGGACACCGAGGCCCAGCAGACCACGCTACACCCACTTGTGGGCCGTGTCTTTGTGCACACCTTGGACCATGAGACGTTTCTGAGCCTTCCTGAGCATGTCGCTGTCCCACCCGCTGTCCACATCACCTACCACGCCCACCTCCAGGGACACCCAGACCTGCCCCGGTGGCTCCGCTACACCCAGCGCAGCCCCCACCACCCTGGCTTCCTCTACGGCTCTGCCACCCCAGAAGATCGTGGGCTCCAGGTCATTGAGGTCACAGCCTACAATCGGGACAGCTTTGATACCACTCGGCAGAGGCTGGTGCTGGAGATTGGGGACCCAGAAGGCCCCCTGCTGCCATACCAAGCCGAGTTCCTGGTGCGCAGCCACGATGCGGAGGAGGTGCTGCCCTCAACACCTGCCAGCCGCTTCCTCTCAGCCTTGGGGGGACTCTGGGAGCCCGGAGAGCTTCAGCTGCTCAACGTCACCTCTGCCTTGGACCGTGGGGGCCGTGTCCCCCTTCCCATTGAGGGCCGAAAAGAAGGGGTATACATTAAGGTGGGTTCTGCCTCACCTTTTTCTACTTGCCTGAAGATGGTGGCATCCCCCGATAGCCACGCCCGCTGTGCCCAGGGCCAGCCTCCACTTCTGTCTTGCTACGACACCTTGGCACCCCACTTCCGCGTTGACTGGTGCAATGTGACCCTGGTGGATAAGTCAGTGCCGGAGCCTGCAGATGAGGTGCCCACCCCAGGTGATGGGATCCTGGAGCATGACCCGTTCTTCTGCCCACCCACTGAGGCCCCAGACCGTGACTTCTTGGTGGATGCTCTGGTCACCCTCCTGGTGCCCCTGCTGGTGGCCCTGCTTCTCACCTTGCTGCTGGCCTATGTCATGTGCTGCCGGCGGGAGGGAAGGCTGAAGAGAGACCTGGCTACCTCCGACATCCAGATGGTCCACCACTGCACCATCCACGGGAACACAGAGGAGCTGCGGCAGATGGCGGCCAGCCGCGAGGTGCCCCGGCCACTCTCCACCCTGCCCATGTTCAATGTGCACACAGGTGAGCGGCTGCCTCCCCGCGTGGACAGCGCCCAGGTGCCCCTCATTCTGGACCAGCACTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MAETLFWTPLLVVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQHCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.19|H|7 Available