hGUHO03840

DGRC Stock Number: 1661982

RRID: RRID:DGRC_1661982

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03840

When publishing experiments using hGUHO03840, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03840 (DGRC Stock 1661982 ; https://dgrc.bio.indiana.edu//stock/1661982 ; RRID:DGRC_1661982)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene RSBN1   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG10600 RSBN1 10 Yes Yes
Base Vector pGW-HA.attB
AA Size 489
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAGAAGTAGGCATGGCTGCGCAGGTCGGAGCGGTGCGCGTAGTACGGGCGGTGGCGGCGCAGGAGGAGCCGGACAAAGAGGGGAAGGAGAAACCTCATGCTGGGGTCTCCCCGCGGGGAGTTAAACGGCAGCGCCGATCTAGCAGTGGGGGGTCTCAGGAGAAGCGGGGGCGGCCGAGCCAGGAGCCCCCTCTCGCTCCCCCTCACCGGCGGCGTCGCAGCCGCCAACATCCTGGGCCGCTGCCGCCAACGAATGCAGCCCCAACTGTCCCAGGCCCTGTTGAGCCTCTTCTCCTGCCGCCTCCGCCGCCACCTTCGCTGGCACCCGCCGGGCCCGCTGTCGCTGCCCCTCTCCCGGCCCCAAGCACCTCGGCCCTCTTCACCTTCTCGCCTCTGACGGTGAGCGCGGCCGGGCCCAAGCATAAGGGCCACAAGGAGCGGCACAAGCACCATCACCACCGCGGCCCCGATGGTGATCCCAGCTCCTGCGGAACCGATCTCAAGCACAAGGACAAGCAGGAAAACGGCGAGAGGACTGGAGGGGTGCCTCTGATCAAAGCCCCCAAGAGAGAAACACCAGATGAAAATGGTAAAACCCAGAGAGCCGATGATTTTGTCTTGAAGAAAATAAAGAAGAAAAAGAAAAAGAAACACCGAGAAGACATGCGAGGAAGACGCCTTAAAATGTACAATAAGGAAGTACAAACCGTCTGTGCTGGCCTGACCCGCATCAGTAAAGAAATTCTCACCCAAGGACAAATAAATAGCACTTCAGGACTTAATAAGGAGTCCTTCAGGTATCTGAAAGATGAACAGCTGTGCCGATTAAATTTGGGTATGCAAGAATATCGGGTACCCCAGGGAGTACAAACACCTTTTATGACTCACCAGGAACATTCTATTCGTAGAAATTTCTTAAAAACAGGTACTAAATTTAGCAACTTTATTCATGAGGAACACCAGTCCAATGGTGGTGCTCTTGTCCTTCATGCTTACATGGATGAACTCTCATTTTTGTCTCCAATGGAGATGGAGAGATTTTCTGAGGAGTTTCTTGCTTTGACATTCAGTGAAAATGAGAAAAATGCTGCTTACTATGCTTTAGCAATAGTGCATGGAGCGGCTGCTTATCTCCCAGACTTCTTGGACTACTTTGCTTTTAATTTCCCCAACACTCCAGTGAAAATGGAAATTCTGGGCAAGAAAGATATTGAAACAACCACCATTTCAAATTTTCACACTCAGTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.19|C|6 Available