hGUHO03111

DGRC Stock Number: 1661845

RRID: RRID:DGRC_1661845

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03111

When publishing experiments using hGUHO03111, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03111 (DGRC Stock 1661845 ; https://dgrc.bio.indiana.edu//stock/1661845 ; RRID:DGRC_1661845)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene SLC25A37   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
mfrn SLC25A37 14 Yes Yes
Base Vector pGW-HA.attB
AA Size 416
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCACCATGGAGCTGCGCAGCGGGAGCGTGGGCAGCCAGGCGGTGGCGCGGAGGATGGATGGGGACAGCCGAGATGGCGGCGGCGGCAAGGACGCCACCGGGTCGGAGGACTACGAGAACCTGCCGACTAGCGCCTCCGTGTCCACCCACATGACAGCAGGAGCGATGGCCGGGATCCTGGAGCACTCGGTCATGTACCCGGTGGACTCGGTGAAGACACGAATGCAGAGTTTGAGTCCAGATCCCAAAGCCCAGTACACAAGTATCTACGGAGCCCTCAAGAAAATCATGCGGACCGAAGGCTTCTGGAGGCCCTTGCGAGGCGTCAACGTCATGATCATGGGTGCAGGGCCAGCCCATGCCATGTATTTTGCCTGCTATGAAAACATGAAAAGGACTTTAAATGACGTTTTCCACCACCAAGGAAACAGCCACCTAGCCAACGGGATAGCTGGGAGTATGGCCACCCTGCTCCACGATGCGGTAATGAATCCAGCAGAAGTGGTGAAGCAGCGCTTGCAGATGTACAACTCGCAGCACCGGTCAGCAATCAGCTGCATCCGGACGGTGTGGAGGACCGAGGGGTTGGGGGCCTTCTACCGGAGCTACACCACGCAGCTGACCATGAACATCCCCTTCCAGTCCATCCACTTCATCACCTATGAGTTCCTGCAGGAGCAGGTCAACCCCCACCGGACCTACAACCCGCAGTCCCACATCATCTCAGGCGGGCTGGCCGGGGCCCTCGCCGCGGCCGCCACGACCCCCCTGGACGTCTGTAAGACCCTTCTGAACACTCAGGAGAACGTGGCCCTCTCGCTGGCCAACATCAGCGGCCGGCTGTCGGGTATGGCCAATGCCTTCCGGACGGTGTACCAGCTCAACGGCCTGGCCGGCTACTTCAAAGGCATCCAGGCGCGTGTCATCTACCAGATGCCCTCCACCGCCATTTCTTGGTCTGTCTATGAGTTCTTCAAGTACTTTCTCACCAAGCGCCAGCTGGAAAATCGAGCTCCATACTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEHSVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRSAISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPYLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.17|H|1 Available