hGUHO03110

DGRC Stock Number: 1661844

RRID: RRID:DGRC_1661844

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03110

When publishing experiments using hGUHO03110, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03110 (DGRC Stock 1661844 ; https://dgrc.bio.indiana.edu//stock/1661844 ; RRID:DGRC_1661844)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene SLC25A40   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG2616 SLC25A40 13 Yes Yes
Shawn SLC25A40 9 Yes No
Tyler SLC25A40 7 Yes No
Base Vector pGW-HA.attB
AA Size 416
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGATCCTGAGACAAGGGGACAAGAGATTATCAAAGTGACACCTCTTCAACAAATGCTTGCCTCATGTACTGGAGCTATACTGACATCAGTAATAGTGACACCCCTGGATGTTGTTAAAATTAGACTCCAAGCCCAAAACAACCCACTCCCCAAAGGAAAATGTTTTGTATATAGTAATGGACTCATGGATCATCTATGTGTCTGTGAAGAGGGAGGCAACAAACTATGGTATAAGAAGCCAGGAAATTTCCAGGGAACATTGGATGCATTTTTTAAAATCATTCGAAATGAGGGCATTAAATCTCTATGGAGTGGCCTTCCTCCTACCCTAGTGATGGCAGTTCCTGCCACAGTTATTTATTTTACCTGCTATGATCAATTAAGTGCTCTTCTGAGATCTAAGTTAGGAGAAAATGAAACCTGCATACCAATTGTTGCTGGAATTGTAGCCAGATTTGGTGCAGTAACTGTGATAAGTCCACTAGAATTGATTAGAACCAAGATGCAGTCCAAGAAGTTTTCTTACGTGGAACTGCATCGATTTGTCAGCAAGAAAGTATCTGAAGATGGTTGGATTTCCCTTTGGAGGGGCTGGGCTCCTACTGTTCTTAGAGATGTACCTTTCTCAGCAATGTACTGGTATAACTATGAAATTTTAAAGAAGTGGTTATGTGAGAAATCTGGTTTATATGAGCCAACATTTATGATCAACTTTACTTCAGGGGCATTGTCTGGTTCTTTTGCTGCTGTTGCAACTTTACCATTTGATGTAGTAAAAACACAAAAGCAGACACAACTTTGGACATATGAAAGTCATAAAATTTCTATGCCTTTGCATATGTCAACCTGGATTATAATGAAGAACATTGTTGCTAAAAATGGATTTTCCGGATTATTTTCAGGCCTAATTCCTCGCTTAATTAAAATTGCTCCTGCTTGTGCCATTATGATCAGTACATATGAATTTGGAAAGGCTTTTTTCCAGAAACAAAATGTTCGAAGGCAGCAATACTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLSALLRSKLGENETCIPIVAGIVARFGAVTVISPLELIRTKMQSKKFSYVELHRFVSKKVSEDGWISLWRGWAPTVLRDVPFSAMYWYNYEILKKWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTYESHKISMPLHMSTWIIMKNIVAKNGFSGLFSGLIPRLIKIAPACAIMISTYEFGKAFFQKQNVRRQQYYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.17|G|12 Available