hGUHO02474

DGRC Stock Number: 1661691

RRID: RRID:DGRC_1661691

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO02474

When publishing experiments using hGUHO02474, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO02474 (DGRC Stock 1661691 ; https://dgrc.bio.indiana.edu//stock/1661691 ; RRID:DGRC_1661691)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene OTUD6B   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG7857 OTUD6B 14 Yes Yes
Base Vector pGW-HA.attB
AA Size 371
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGAGGCGGTATTGACCGAAGAGCTTGATGAGGAAGAGCAGCTGCTGAGAAGGCATCGCAAAGAGAAGAAGGAGTTGCAAGCCAAAATTCAGGGCATGAAGAATGCTGTTCCCAAGAATGACAAGAAGAGGAGGAAGCAGCTCACCGAAGATGTGGCCAAGTTGGAAAAAGAAATGGAACAGAAACATAGAGAGGAACTGGAGCAATTGAAGCTGACTACTAAGGAGAATAAGATAGATTCTGTTGCTGTTAACATTTCAAACTTGGTGCTTGAGAATCAGCCACCTCGGATATCAAAAGCACAAAAGAGACGGGAAAAGAAAGCTGCATTGGAAAAGGAGCGAGAAGAACGGATAGCTGAAGCTGAAATTGAAAACTTAACAGGAGCCAGACATATGGAAAGTGAGAAACTTGCTCAAATATTGGCAGCTAGACAGTTAGAAATTAAACAGATTCCATCTGATGGCCACTGTATGTATAAAGCCATTGAAGATCAACTGAAAGAAAAGGATTGTGCTCTGACTGTGGTTGCCTTGAGAAGTCAGACCGCTGAGTATATGCAAAGCCATGTGGAAGACTTTCTGCCATTTTTAACAAACCCTAATACAGGAGATATGTATACTCCAGAAGAATTTCAGAAGTACTGTGAAGATATTGTAAACACAGCTGCATGGGGAGGTCAGCTTGAGCTAAGAGCTCTGTCTCACATTTTACAAACACCAATAGAGATAATACAGGCAGATTCTCCTCCCATTATAGTTGGTGAAGAATATTCAAAAAAACCACTAATACTTGTATATATGAGACATGCATATGGCTTAGGAGAACATTATAATTCGGTTACACGGTTGGTAAACATAGTTACTGAAAATTGCAGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCSYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 3' End ACCCACTTTGTGTAACAAGAAAAGTTTGGGGTAGCTGGCATTTTTCCAGTAACTAATGTTTTACCAAC
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.16|C|3 Available