hGUHO02036

DGRC Stock Number: 1661552

RRID: RRID:DGRC_1661552

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO02036

When publishing experiments using hGUHO02036, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO02036 (DGRC Stock 1661552 ; https://dgrc.bio.indiana.edu//stock/1661552 ; RRID:DGRC_1661552)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene CCDC42   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG10750 CCDC42 8 No Yes
CG17564 CCDC42 8 Yes Yes
Base Vector pGW-HA.attB
AA Size 320
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGAGTCTGGGCATCATGGAAGAGGAAGACCTGGCCGAGTACTTCCGGCTGCAGTATGGGGAGCGGCTGCTGCAGATGCTCCAGAAACTCCCCAATGTTGAGGGGGCGTCGGAGTCCCCATCCATCTGGCTACTGGAGAAGAAAAAGGAGACAGAAATCATGCATCAAACTATGGTGCAGAAGAAGAAGATGTTTCAGCGCAGAATGGAAACCCTGAACCTGCGCTGGGAGGAACTGGGCGTTAAGGAAGCCCAACTGAAGGCTCACATCCAGAAGTCTGAGCAGTTCATCCAGGAGAACGACCAGAAACGGATCCGCGCCATGAAGAAAGCCAACAAGGAGCGAGAACTCAAGTGCCAGCACATGCAGGAGCTGACCAAGCGCAAGCAGGAGATGGTGGCGCTGCGGCTGGAGCACCAGCGGCTGAGCGCCAAGCTGAAGGACTACTACATCTTCAACAAGTACCTAGAGAAGGTGGTGGAGAACTCCGAGGAATCTCGCTGGGCGCACATCCAGAACACCGCAGCCAAGAAGACCCTCCTGCTTGGCACCATTAAGATGGCCACGCTGAACCTCTTCCAGATCGTGAGCAAGCACCTGAAGGAGGTGACTGAGGTGGCACTGGAGGACACCCACAAGCAGCTGGACATGATCCAGCAATTTATCCAAGACCGGTCGGACATCTGGGCAGAGGTGAAAAAGAAGGAACAACAGCGAGTCCGGATTTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYYIFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEVALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRIYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.14|G|8 Available