hGUHO04665

DGRC Stock Number: 1662287

RRID: RRID:DGRC_1662287

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO04665

When publishing experiments using hGUHO04665, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO04665 (DGRC Stock 1662287 ; https://dgrc.bio.indiana.edu//stock/1662287 ; RRID:DGRC_1662287)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene FAM126A   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG6406 FAM126A 12 Yes Yes
Base Vector pGW-HA.attB
AA Size 599
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGTTGCTAGAACCTGTCTGTCACCAGCTCTTTGAATTCTATCGCAGTGGAGAGGAGCAGTTGCTTCAATTTACGCTGCAATTTCTCCCAGAACTAATTTGGTGCTACCTTGCAGTCTCAGCCAGCAGAAATGTGCATAGCAGTGGATGCATTGAAGCTCTTCTTCTAGGGGTTTACAATTTGGAAATAGTTGACAAACAGGGACATACCAAAGTATTGAGTTTTACGATTCCATCTTTATCCAAACCATCTGTATACCATGAACCTTCCAGCATTGGGTCCATGGCTCTGACTGAGAGTGCACTATCCCAGCATGGTTTGTCAAAAGTGGTATACAGTGGACCTCATCCTCAAAGGGAGATGCTGACAGCACAGAATCGGTTTGAAGTGTTGACATTCCTTTTGTTGTGTTACAATGCTGCCTTAACTTACATGCCCAGTGTTTCTCTTCAGTCACTGTGTCAAATTTGTTCAAGAATCTGTGTTTGTGGATATCCTCGACAACATGTAAGAAAATATAAAGGTATAAGTAGCAGGATACCAGTTTCTTCAGGATTCATGGTGCAAATGTTAACAGGGATTTATTTTGCCTTTTATAATGGAGAATGGGATCTAGCTCAAAAAGCACTGGATGATATTATATACAGAGCCCAGCTAGAATTATATCCAGAGCCATTGCTGGTTGCTAATGCAATAAAGGCTTCATTGCCTCATGGTCCCATGAAATCTAATAAGGAAGGTACAAGGTGTATTCAAGTTGAAATCACACCAACTTCCTCTCGAATATCAAGAAATGCAGTAACCAGCATGTCAATAAGGGGTCATAGGTGGAAAAGACATGGAAATACAGAATTAACAGGTCAAGAAGAACTGATGGAGATATCTGAAGTTGACGAGGGATTTTATTCCAGGGCTGCGTCTAGTACCAGCCAGTCGGGTTTATCAAACAGTAGTCACAATTGTAGTAACAAGCCAAGTATAGGAAAGAACCACAGACGGTCAGGAGGAAGCAAAACTGGAGGAAAAGAAAAAGAAACTACAGGGGAATCTTGCAAAGATCACTTTGCTCGAAAACAAACTCAGAGAGCCCAAAGTGAGAATCTTGAGCTTCTCTCTTTGAAGAGACTTACTTTAACAACCAGCCAATCCCTACCTAAGCCTAGTAGCCATGGTTTGGCTAAGACCGCAGCGACTGTATTTAGTAAATCCTTTGAACAAGTCAGTGGTGTCACAGTCCCACATAACCCGTCATCTGCTGTTGGTTGTGGGGCTGGGACAGATGCCAATAGGTTTTCCGCTTGTAGTCTCCAAGAAGAAAAGCTTATTTACGTTTCAGAAAGAACTGAACTTCCAATGAAGCATCAATCAGGTCAGCAGAGACCTCCTAGTATTAGCATTACTCTGTCCACAGATTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MFTSEKGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSASRNVHSSGCIEALLLGVYNLEIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLPHGPMKSNKEGTRCIQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGESCKDHFARKQTQRAQSENLELLSLKRLTLTTSQSLPKPSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQRPPSISITLSTDYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTTTACCAAATTATGCCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGAGCCACAAAGTGAGTTGCTAGAACCTGTCTGTCACCAGCTCTTTGAATTCTATCGCAGTGGAGAGGAGCAGTTGCTTCAATTTACGCTGCAATTTCTCCCAGAACTAATTTGGTGCTACCTTGCAGTCTCAGCCAGCAGAAATGTGCATAGCAGTGGATGCATTGAAGCTCTTCTTCTAGGGGTTTACAATTTGGAAATAGTTGACAAACAGGGACATACCAAAGTATTGAGTTTTACGATTCCATCTTTATCCAAACCATCTGTATACCATGAACCTTCCAGCATTGGGTCCATGGCTCTGACTGAGAGTGCACTATCCCAGCATGGGTTTGTCAAAAGTGGTATACAGTGGACCTCATCCTCAAAGGGAGATGCTGACAGCACAGAATCGGGTTTGAAGTGTGACATTCCTTTTGTGTGTTACAATGCTGCCTAACTACATGCCAGTGTTCTCTCAGTCACTGTGTCAATTTGTCCAGATCTGTGTTTGTGGATATCCTCGACACATGTAGAAATATAAAGGTATAGTAGCAGATACAGTTCTCAGAATCATGTGCAATGTACACGATTATTTGCTTTATATGAGATGGATCTAGCTCAAAGCACTGGATGAT
Sequenced 3' End TCAAGCGTAATCTGGAACGTCATATGGATAGGATCCTGCATAGTCCGGGACGTCATAGGGATAGCCCGCATAGTCAGGAACATCGTATGGGTAAATTAACCCCGCAGGTCCACCGGCTCCACCAGCGCCAGCAGTAGCACCGCCTCCTGAAGGAGCTCCAAGGATG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.22|D|11 Available