hGUHO04621

DGRC Stock Number: 1662252

RRID: RRID:DGRC_1662252

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO04621

When publishing experiments using hGUHO04621, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO04621 (DGRC Stock 1662252 ; https://dgrc.bio.indiana.edu//stock/1662252 ; RRID:DGRC_1662252)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene JADE1   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
rno JADE1 7 No Yes
Base Vector pGW-HA.attB
AA Size 587
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGAAACGAGGTCGCCTTCCCAGCAGCAGTGAGGATTCTGACGACAATGGCAGCCTGTCAACTACTTGGTCCCAGAATTCCCGATCCCAGCATAGGAGAAGCTCCTGCTCCAGACATGAAGATCGAAAGCCTTCAGAGGTGTTTAGGACAGACCTGATCACTGCCATGAAGTTGCATGACTCCTACCAGCTGAATCCGGATGAGTACTATGTGTTGGCAGATCCCTGGAGACAGGAATGGGAGAAAGGGGTCCAGGTGCCTGTGAGCCCGGGGACCATCCCTCAGCCTGTGGCCAGGGTTGTGTCTGAAGAGAAATCCCTCATGTTCATCAGGCCCAAGAAGTACATCGTGTCATCAGGCTCTGAGCCTCCCGAGTTGGGCTATGTGGACATCCGGACGCTGGCTGACAGCGTGTGTCGCTATGACCTCAATGACATGGATGCTGCATGGCTGGAACTGACCAATGAAGAATTTAAGGAGATGGGAATGCCTGAACTAGATGAATACACCATGGAGAGGGTCCTAGAGGAATTTGAGCAGCGATGCTACGACAATATGAATCATGCCATAGAGACTGAGGAAGGCCTGGGGATCGAATATGATGAAGATGTTGTCTGTGATGTCTGCCAGTCTCCTGATGGTGAGGACGGCAATGAGATGGTGTTCTGTGACAAATGCAACATCTGTGTGCACCAGGCCTGTTATGGAATCCTCAAGGTACCAGAGGGCAGCTGGCTGTGCCGGACATGTGCCCTGGGGGTTCAGCCAAAATGTCTGCTGTGTCCGAAGAAGGGTGGAGCTATGAAGCCCACCCGTAGCGGAACCAAGTGGGTCCACGTTAGCTGTGCTCTGTGGATCCCTGAGGTGAGCATTGGCAGCCCAGAGAAGATGGAGCCCATCACCAAGGTGTCACACATTCCCAGCAGCCGGTGGGCGCTAGTGTGCAGCCTCTGCAATGAGAAGTTTGGGGCCTCTATACAGTGCTCTGTGAAGAACTGCCGCACAGCCTTCCATGTGACCTGTGCTTTTGACCGGGGCCTGGAGATGAAGACCATCTTAGCAGAGAATGATGAAGTCAAGTTCAAGTCCTATTGCCCAAAGCACAGCTCACATAGGAAACCCGAGGAGAGTCTTGGCAAGGGGGCTGCACAGGAGAATGGGGCCCCTGAGTGTTCCCCCCGGAATCCGCTGGAGCCCTTTGCCAGCCTTGAGCAGAACCGGGAGGAGGCCCACCGGGTGAGTGTCCGTAAGCAGAAGCTGCAGCAGTTGGAGGATGAGTTCTACACCTTCGTCAACCTGCTGGATGTTGCCAGGGCTCTGCGGCTGCCTGAGGAAGTAGTGGATTTCCTGTACCAGTACTGGAAGTTGAAGAGGAAGGTCAACTTCAACAAGCCCCTGATCACCCCAAAGAAAGATGAAGAGGACAATCTAGCCAAGCGGGAGCAGGATGTCTTATTTAGGAGGCTGCAGCTGTTCACGCACCTGCGGCAGGACCTGGAGAGGGTAATGATTGACACTGACACCTTATACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLERVMIDTDTLYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCATGAAACGAGGTCGCCTTCCCAGCAGCAGTGAGGATTCTGACGACAATGGCAGCCTGTCAACTACTTGGTCCCAGAATTCCCGATCCCAGCATAGGAGAAGCTCCTGCTCCAGACATGAAGATCGAAAGCCTTCAGAGGTGTTTAGGACAGACCTGATCACTGCCATGAAGTTGCATGACTCCTACCAGCTGAATCCGGATGAGTACTATGTGTTGGCAGATCCCTGGAGACAGGAATGGGAGAAAGGGGTCCAGGTGCCTGTGAGCCCGGGGACCATCCCTCAGCCTGTGGCCAGGGTTGTGTCTGAAGAGAAATCCCTCATGTTCATCAGGCCCAAGAAGTACATCGTGTCATCAGGCTCTGAGCCTCCCGAGTTGGGCTATGTGGACATCCGGACGCTGGCTGACAGCGTGTGTCGCTATGACCTCAATGACATGGATGCTGCATGGCTGGAACTGACCAATGAAGAATTTAAGGAGATGGGAATGCCTGAACTAGATGAATACACCATGGAGAGGGTCCTAGAGGAATTTGAGCAGCGATGCTACGACAATATGAATCATGCCATAGAGACTGAGGAAGGCCTGGGGATCGAATATGATGAAGATGTTGTCTGTGATGTCTGCCAGTCTCCTGATGGTGAGGACGGCAATGAGATGGTGTTCTGTGACAAATGCAACATCTGTGTGCACCAGGCCTGTTATGGAATCCTCAAGGTACCAGAGGGCAGCTGGCTGTGCCGGACATGTGCCCTGGGGGTTCAGCCAAATGTCTGCTGTGTCCGAAGAAAGGTGGAGCTATGAAGCCCACCCGTAGCGGAACAAAATGGGTCCCCGTTAGCTGTGGT
Sequenced 3' End TCAAGCGTAATCTGGAACGTCATATGGATAGGATCCTGCATAGTCCGGGACGTCATAGGGATAGCCCGCATAGTCAGGAACATCGTATGGGTAAATTAACCCCGCAGGTCCACCGGCTCCACCAGCGCCAGCAGTAGCACCGCCTCCTGAAGGAGCTCCAAGGATG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.22|A|12 Available