hGUHO04432

DGRC Stock Number: 1662217

RRID: RRID:DGRC_1662217

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO04432

When publishing experiments using hGUHO04432, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO04432 (DGRC Stock 1662217 ; https://dgrc.bio.indiana.edu//stock/1662217 ; RRID:DGRC_1662217)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene ZRSR2   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG3294 ZRSR2 12 Yes Yes
Base Vector pGW-HA.attB
AA Size 560
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCACCATGGCTGCGCCCGAGAAGATGACGTTTCCCGAGAAACCAAGCCACAAAAAGTACAGGGCCGCCCTGAAGAAGGAGAAACGAAAGAAACGTCGGCAGGAACTTGCTCGACTGAGAGACTCAGGACTCTCACAGAAGGAGGAAGAGGAGGACACTTTTATTGAAGAACAACAACTAGAAGAAGAGAAGCTATTGGAAAGAGAGAGGCAAAGATTACATGAGGAGTGGTTGCTAAGAGAGCAGAAGGCACAAGAAGAATTCAGAATAAAGAAGGAAAAGGAAGAGGCGGCTAAAAAACGGCAAGAAGAACAAGAGAGAAAGTTAAAGGAACAATGGGAAGAACAGCAGAGGAAAGAGAGAGAAGAGGAGGAGCAGAAACGACAGGAGAAGAAAGAAAAAGAGGAAGCTTTGCAGAAGATGCTGGATCAGGCTGAAAATGAGTTGGAAAATGGTACCACATGGCAAAACCCAGAACCACCCGTGGATTTCAGAGTAATGGAGAAGGATCGAGCTAATTGTCCCTTCTACAGTAAAACAGGAGCTTGCAGATTTGGAGATAGATGTTCACGTAAACATAATTTCCCAACATCCAGTCCTACCCTTCTTATTAAGAGCATGTTTACGACGTTTGGAATGGAGCAGTGCAGGAGGGATGACTATGACCCTGACGCAAGCCTGGAGTACAGCGAGGAAGAAACCTACCAACAGTTCCTAGACTTCTATGAGGATGTGTTGCCCGAGTTCAAGAACGTGGGGAAAGTGATTCAGTTCAAGGTCAGCTGCAATTTGGAACCTCACCTGAGGGGCAATGTATATGTTCAGTACCAGTCGGAAGAAGAATGCCAAGCAGCCCTTTCTCTGTTTAACGGACGATGGTATGCAGGACGACAGCTGCAGTGTGAATTCTGCCCCGTGACCCGGTGGAAAATGGCGATTTGTGGTTTATTTGAAATACAACAATGTCCAAGAGGAAAGCACTGCAACTTTCTTCATGTGTTCAGAAATCCCAACAATGAATTCTGGGAAGCTAATAGAGACATCTACTTGTCTCCAGATCGGACTGGCTCCTCCTTTGGGAAGAACTCCGAAAGGAGGGAGAGGATGGGCCACCACGACGACTACTACAGCAGGCTGCGGGGAAGGAGAAACCCTAGTCCAGACCACTCCTACAAAAGAAATGGGGAATCCGAGAGGAAAAGTAGTCGTCACAGGGGGAAGAAATCTCACAAACGCACATCAAAGAGTCGGGAGAGGCACAATTCACGAAGCAGAGGAAGAAATAGGGACCGCAGCAGGGACCGCAGCCGGGGCCGGGGCAGCCGGAGCCGGAGCCGGAGCCGGAGCCGCAGGAGCCGCCGCAGCCGGAGCCAAAGTTCCTCTAGGTCCCGAAGTCGTGGCAGGAGGAGGTCGGGTAATAGAGACAGAACTGTTCAGAGTCCCAAATCCAAATTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSKLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCACCATGGCTGCGCCCGAGAAGATGACGTTTCCCGAGAAACCAAGCCACAAAAAGTACAGGGCCGCCCTGAAGAAGGAGAAACGAAAGAAACGTCGGCAGGAACTTGCTCGACTGAGAGACTCAGGACTCTCACAGAAGGAGGAAGAGGAGGACACTTTTATTGAAGAACAACAACTAGAAGAAGAGAAGCTATTGGAAAGAGAGAGGCAAAGATTACATGAGGAGTGGTTGCTAAGAGAGCAGAAGGCACAAGAAGAATTCAGAATAAAGAAGGAAAAGGAAGAGGCGGCTAAAAAACGGCAAGAAGAACAAGAGAGAAAGTTAAAGGAACAATGGGAAGAACAGCAGAGGAAAGAGAGAGAAGAGGAGGAGCAGAAACGACAGGAGAAGAAAGAAAAAGAGGAAGCTTTGCAGAAGATGCTGGATCAGGCTGAAAATGAGTTGGAAAATGGTACCACATGGCAAAACCCAGAACCACCCGTGGATTTCAGAGTAATGTAGAAAGGATCGAGCTAATTGTCCCTTCTACAGTAAAACAGGAGCTTGCAGATTTGGAGATAGATGTTCACGTAAACATAATTTCCCAACATCCAGTCCTACCCTTCTTATTAGAGCATGTTTACGACGTTTGGAATGGAGCAGTGCAGAGGATGACTATGACCCTGACGCAGCCTGAGTACAGCGAGGAGAACTACCAACAGTTCCTAGACTTCTATGAGATGTGTTGCCCGAGTTCAGACGTGGGAAGTGATCAGTTCAAGGTCAGCTGCATTTGACCTCACTGAGGGCATGTTTTATGTTCAGTACCAGTCGAAGAAGAATGCAAGCAGCCTTTCTCTGTTTAACGACGATGTATGCAGACGACGCTGCATGTGATTCTGCCCTGACCGGTGAAATGGCGAAT
Sequenced 3' End TCAAGCGTAATCTGGAACGTCATATGGATAGGATCCTGCATAGTCCGGGACGTCATAGGGATAGCCCGCATAGTCAGGAACATCGTATGGGTAAATTAACCCCGCAGGTCCACCGGCTCCACCAGCGCCAGCAGTAGCACCGCCTCCTGAAGGAGCTCCAAGGATG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.21|G|1 Available