hGUHO03221

DGRC Stock Number: 1662141

RRID: RRID:DGRC_1662141

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03221

When publishing experiments using hGUHO03221, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03221 (DGRC Stock 1662141 ; https://dgrc.bio.indiana.edu//stock/1662141 ; RRID:DGRC_1662141)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene YBX2   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
yps YBX2 6 No Yes
Base Vector pGW-HA.attB
AA Size 442
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGAGCGAGGTGGAGGCGGCAGCGGGGGCTACAGCGGTCCCCGCGGCGACGGTGCCCGCGACGGCGGCAGGGGTGGTAGCGGTGGTGGTACCGGTGCCCGCAGGGGAGCCGCAGAAAGGCGGCGGGGCGGGCGGCGGGGGCGGAGCCGCCTCGGGCCCCGCTGCTGGGACCCCCTCGGCGCCGGGCTCCCGCACCCCTGGCAATCCGGCGACGGCGGTCTCGGGAACCCCCGCCCCCCCGGCCCGGAGTCAGGCGGACAAGCCGGTGCTGGCAATCCAAGTCCTGGGCACTGTCAAATGGTTCAACGTCCGGAATGGTTACGGATTCATCAACAGGAATGACACCAAGGAAGATGTCTTTGTTCACCAGACAGCTATTAAAAGAAACAACCCCAGGAAGTTTCTGCGCAGCGTTGGAGATGGGGAGACTGTGGAATTTGATGTCGTGGAAGGAGAGAAGGGCGCAGAAGCCACTAATGTAACTGGGCCTGGGGGAGTACCCGTGAAGGGCAGCCGTTATGCCCCCAACCGACGTAAGTCCCGCCGATTCATCCCCCGGCCTCCCTCAGTTGCCCCACCACCCATGGTGGCAGAGATCCCCTCGGCGGGGACAGGACCTGGCAGTAAAGGGGAGCGGGCTGAAGACTCTGGGCAACGGCCCCGACGATGGTGCCCCCCACCCTTCTTCTACCGACGGCGGTTTGTGCGAGGCCCCCGGCCTCCCAACCAGCAGCAGCCTATAGAGGGCACTGACAGGGTAGAACCCAAAGAGACAGCCCCATTGGAGGGGCACCAACAGCAGGGAGATGAGCGAGTCCCCCCGCCCAGATTCCGGCCCAGGTACCGAAGGCCTTTCCGCCCCAGGCCACGCCAGCAGCCTACCACAGAAGGTGGGGATGGTGAGACCAAGCCCAGCCAAGGTCCCGCTGATGGTTCCCGGCCTGAGCCCCAGCGCCCACGAAACCGCCCCTACTTCCAGCGGAGACGGCAGCAGGCCCCTGGCCCCCAGCAGGCCCCTGGCCCCCGGCAGCCCGCAGCCCCTGAGACCTCAGCCCCTGTCAACAGTGGGGACCCCACCACCACCATCCTGGAGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILECPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.20|H|9 Available