hGUHO03674

DGRC Stock Number: 1662023

RRID: RRID:DGRC_1662023

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03674

When publishing experiments using hGUHO03674, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03674 (DGRC Stock 1662023 ; https://dgrc.bio.indiana.edu//stock/1662023 ; RRID:DGRC_1662023)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene CTSE   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
pcl CTSE 6 Yes No
CG33128 CTSE 6 Yes No
Bace CTSE 9 Yes Yes
CG17134 CTSE 8 Yes No
Base Vector pGW-HA.attB
AA Size 474
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGAAAACGCTCCTTCTTTTGCTGCTGGTGCTCCTGGAGCTGGGAGAGGCCCAAGGATCCCTTCACAGGGTGCCCCTCAGGAGGCATCCGTCCCTCAAGAAGAAGCTGCGGGCACGGAGCCAGCTCTCTGAGTTCTGGAAATCCCATAATTTGGACATGATCCAGTTCACCGAGTCCTGCTCAATGGACCAGAGTGCCAAGGAACCCCTCATCAACTACTTGGATATGGAATACTTCGGCACTATCTCCATTGGCTCCCCACCACAGAACTTCACTGTCATCTTCGACACTGGCTCCTCCAACCTCTGGGTCCCCTCTGTGTACTGCACTAGCCCAGCCTGCAAGACGCACAGCAGGTTCCAGCCTTCCCAGTCCAGCACATACAGCCAGCCAGGTCAATCTTTCTCCATTCAGTATGGAACCGGGAGCTTGTCCGGGATCATTGGAGCCGACCAAGTCTCTGTGGAAGGACTAACCGTGGTTGGCCAGCAGTTTGGAGAAAGTGTCACAGAGCCAGGCCAGACCTTTGTGGATGCAGAGTTTGATGGAATTCTGGGCCTGGGATACCCCTCCTTGGCTGTGGGAGGAGTGACTCCAGTATTTGACAACATGATGGCTCAGAACCTGGTGGACTTGCCGATGTTTTCTGTCTACATGAGCAGTAACCCAGAAGGTGGTGCGGGGAGCGAGCTGATTTTTGGAGGCTACGACCACTCCCATTTCTCTGGGAGCCTGAATTGGGTCCCAGTCACCAAGCAAGCTTACTGGCAGATTGCACTGGATAACATCCAGGTGGGAGGCACTGTTATGTTCTGCTCCGAGGGCTGCCAGGCCATTGTGGACACAGGGACTTCCCTCATCACTGGCCCTTCCGACAAGATTAAGCAGCTGCAAAACGCCATTGGGGCAGCCCCCGTGGATGGAGAATATGCTGTGGAGTGTGCCAACCTTAACGTCATGCCGGATGTCACCTTCACCATTAACGGAGTCCCCTATACCCTCAGCCCAACTGCCTACACCCTACTGGACTTCGTGGATGGAATGCAGTTCTGCAGCAGTGGCTTTCAAGGACTTGACATCCACCCTCCAGCTGGGCCCCTCTGGATCCTGGGGGATGTCTTCATTCGACAGTTTTACTCAGTCTTTGACCGTGGGAATAACCGTGTGGGACTGGCCCCAGCAGTCCCCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.19|F|11 Available