hGUHO03821

DGRC Stock Number: 1662009

RRID: RRID:DGRC_1662009

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03821

When publishing experiments using hGUHO03821, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03821 (DGRC Stock 1662009 ; https://dgrc.bio.indiana.edu//stock/1662009 ; RRID:DGRC_1662009)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene TMEM184B   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG12004 TMEM184B 13 Yes Yes
Base Vector pGW-HA.attB
AA Size 485
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGACAGTGAGGGGGGATGTGCTGGCCCCGGATCCAGCGTCGCCCACGACCGCAGCAGCCTCGCCCAGCGTCTCCGTGATCCCCGAGGGCAGCCCCACTGCCATGGAGCAGCCTGTGTTCCTGATGACAACTGCCGCTCAGGCCATCTCTGGCTTCTTCGTGTGGACGGCCCTGCTCATCACATGCCACCAGATCTACATGCACCTGCGCTGCTACAGCTGCCCCAACGAGCAGCGCTACATCGTGCGCATCCTCTTCATCGTGCCCATCTACGCCTTTGACTCCTGGCTCAGCCTCCTCTTCTTCACCAACGACCAGTACTACGTGTACTTCGGCACCGTCCGCGACTGCTATGAGGCCTTGGTCATCTATAATTTCCTGAGCCTGTGCTATGAGTACCTAGGAGGAGAAAGTTCCATCATGTCGGAGATCAGAGGAAAACCCATTGAGTCCAGCTGTATGTATGGCACCTGCTGCCTCTGGGGAAAGACTTATTCCATCGGATTTCTGAGGTTCTGCAAACAGGCCACCCTGCAGTTCTGTGTGGTGAAGCCACTCATGGCGGTCAGCACTGTGGTCCTCCAGGCCTTCGGCAAGTACCGGGATGGGGACTTTGACGTCACCAGTGGCTACCTCTACGTGACCATCATCTACAACATCTCCGTCAGCCTGGCCCTCTACGCCCTCTTCCTCTTCTACTTCGCCACCCGGGAGCTGCTCAGCCCCTACAGCCCCGTCCTCAAGTTCTTCATGGTCAAGTCCGTCATCTTTCTTTCCTTCTGGCAAGGCATGCTCCTGGCCATCCTGGAGAAGTGTGGGGCCATCCCCAAAATCCACTCGGCCCGCGTGTCGGTGGGCGAGGGCACCGTGGCTGCCGGCTACCAGGACTTCATCATCTGTGTGGAGATGTTCTTTGCAGCCCTGGCCCTGCGGCACGCCTTCACCTACAAGGTCTATGCTGACAAGAGGCTGGACGCACAAGGCCGCTGTGCCCCCATGAAGAGCATCTCCAGCAGCCTCAAGGAGACCATGAACCCGCACGACATCGTGCAGGACGCCATCCACAACTTCTCACCTGCCTACCAGCAGTACACGCAGCAGTCCACCCTGGAGCCTGGGCCCACCTGGCGTGGTGGCGCCCACGGCCTCTCCCGCTCCCACAGCCTCAGTGGCGCCCGCGACAACGAGAAGACTCTCCTGCTCAGCTCTGATGATGAATTCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MTVRGDVLAPDPASPTTAAASPSVSVIPEGSPTAMEQPVFLMTTAAQAISGFFVWTALLITCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEALVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQFCVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEFYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.19|E|9 Available