hGUHO03645

DGRC Stock Number: 1661955

RRID: RRID:DGRC_1661955

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03645

When publishing experiments using hGUHO03645, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03645 (DGRC Stock 1661955 ; https://dgrc.bio.indiana.edu//stock/1661955 ; RRID:DGRC_1661955)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene EN1   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
en EN1 10 Yes Yes
inv EN1 9 Yes No
Base Vector pGW-HA.attB
AA Size 473
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGCAGAAGGGCCGTCAAGGCCCACCATGGAAGAACAGCAGCCGGAACCTAAAAGTCAGCGCGACTCGGCCCTCGGCGCGGCGGCGGCGGCGACTCCGGGCGGCCTCAGCCTGAGCCTCAGTCCGGGCGCCAGCGGCAGCAGCGGCAGCGGCAGCGATGGAGACAGCGTGCCGGTGTCCCCGCAGCCTGCGCCCCCCTCGCCGCCCGCGGCGCCTTGCCTGCCGCCCCTGGCCCACCACCCGCACCTCCCCCCACACCCCCCGCCCCCGCCGCCTCAGCATCTCGCGGCGCCTGCTCACCAGCCGCAGCCAGCGGCCCAGCTGCACCGCACCACCAACTTTTTCATCGACAACATCCTGAGGCCGGACTTCGGCTGCAAAAAGGAGCAGCCGCCACCGCAGCTTCTGGTGGCTGCGGCGGCCAGAGGAGGCGCAGGAGGAGGAGGCCGGGTCGAGCGTGACAGAGGCCAGACTGCCGCAGGTAGAGACCCTGTCCACCCGTTGGGCACCCGGGCGCCAGGCGCTGCCTCGCTCCTGTGCGCCCCGGACGCGAACTGTGGCCCACCCGACGGCTCCCAGCCAGCCGCCGCCGGCGCGGGCGCGTCTAAAGCTGGGAACCCGGCTGCGGCGGCGGCGGCGGCCGCGGCGGCAGTGGCGGCGGCGGCGGCGGCCGCAGCAGCCAAGCCCTCGGACACCGGTGGCGGCGGCAGTGGAGGCGGCGCGGGGAGCCCCGGAGCGCAGGGCACCAAATACCCGGAGCACGGCAACCCGGCTATCCTACTTATGGGCTCAGCCAACGGCGGGCCCGTGGTCAAAACTGACTCGCAGCAGCCTCTCGTATGGCCCGCCTGGGTGTACTGCACACGTTATTCGGATCGTCCATCCTCCGGTCCGCGCACCAGGAAGCTGAAGAAGAAGAAGAACGAGAAGGAGGACAAGCGGCCGCGGACCGCGTTCACGGCCGAGCAGCTGCAGAGACTCAAGGCGGAGTTCCAGGCAAACCGCTACATCACGGAGCAGCGGCGGCAGACCCTGGCCCAGGAACTCAGCCTCAACGAGTCCCAGATCAAGATCTGGTTCCAGAACAAGCGCGCCAAGATCAAGAAAGCCACAGGCATCAAGAACGGCCTGGCGCTGCACCTCATGGCCCAGGGACTGTACAACCACTCCACCACCACGGTCCAGGACAAAGACGAGAGCGAGGGCCTCATGGGCCCAGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESEGLMGPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.19|A|3 Available