hGUHO03832

DGRC Stock Number: 1661948

RRID: RRID:DGRC_1661948

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03832

When publishing experiments using hGUHO03832, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03832 (DGRC Stock 1661948 ; https://dgrc.bio.indiana.edu//stock/1661948 ; RRID:DGRC_1661948)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene NAGA   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG5731 NAGA 13 Yes Yes
CG7997 NAGA 12 Yes No
Base Vector pGW-HA.attB
AA Size 488
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCACCATGCTGCTGAAGACAGTGCTCTTGCTGGGACATGTGGCCCAGGTGCTGATGCTGGACAATGGGCTCCTGCAGACACCACCCATGGGCTGGCTGGCCTGGGAACGCTTCCGCTGCAACATTAACTGTGATGAGGACCCAAAGAACTGCATAAGTGAACAGCTCTTCATGGAGATGGCTGACCGGATGGCACAGGATGGATGGCGGGACATGGGCTACACATACCTCAACATTGATGACTGCTGGATCGGTGGTCGCGATGCCAGTGGCCGCCTGATGCCGGATCCCAAGCGCTTCCCTCATGGCATTCCTTTCCTGGCTGACTACGTTCACTCCCTGGGCCTGAAGTTGGGTATCTACGCGGACATGGGCAACTTCACCTGCATGGGTTACCCAGGCACCACACTGGACAAGGTGGTCCAGGATGCTCAGACCTTCGCCGAGTGGAAGGTAGACATGCTCAAGCTGGATGGCTGCTTCTCCACCCCCGAGGAGCGGGCCCAGGGGTACCCCAAGATGGCTGCTGCCCTGAATGCCACAGGCCGCCCCATCGCCTTCTCCTGCAGCTGGCCAGCCTATGAAGGCGGCCTCCCCCCAAGGGTGAACTACAGTCTGCTGGCGGACATCTGCAACCTCTGGCGTAACTATGATGACATCCAGGACTCCTGGTGGAGCGTGCTCTCCATCCTGAATTGGTTCGTGGAGCACCAGGACATACTGCAGCCAGTGGCCGGCCCTGGGCACTGGAATGACCCTGACATGCTGCTCATTGGGAACTTTGGTCTCAGCTTAGAGCAATCCCGGGCCCAGATGGCCCTGTGGACGGTGCTGGCAGCCCCCCTCTTGATGTCCACAGACCTGCGTACCATCTCCGCCCAGAACATGGACATTCTGCAGAATCCACTCATGATCAAAATCAACCAGGATCCCTTAGGCATCCAGGGACGCAGGATTCACAAGGAAAAATCTCTCATCGAAGTGTACATGCGGCCTCTGTCCAACAAGGCTAGCGCCTTAGTCTTCTTCAGCTGCAGGACCGATATGCCTTATCGCTACCACTCCTCCCTTGGCCAGCTGAACTTCACCGGGTCTGTGATATATGAGGCCCAGGACGTCTACTCAGGTGACATCATCAGTGGCCTCCGAGATGAAACCAACTTCACAGTGATCATCAACCCTTCAGGGGTAGTGATGTGGTACCTGTATCCCATCAAGAACCTGGAGATGTCCCAGCAGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.18|H|8 Available