hGUHO03026

DGRC Stock Number: 1661802

RRID: RRID:DGRC_1661802

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03026

When publishing experiments using hGUHO03026, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03026 (DGRC Stock 1661802 ; https://dgrc.bio.indiana.edu//stock/1661802 ; RRID:DGRC_1661802)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene ABHD4   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG1882 ABHD4 15 Yes Yes
Base Vector pGW-HA.attB
AA Size 420
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGCCGATGATCTGGAGCAGCAGTCTCAAGGCTGGCTGAGTAGCTGGCTGCCCACGTGGCGCCCCACTTCCATGTCTCAGCTGAAGAATGTGGAAGCCAGGATCCTCCAGTGTCTCCAGAATAAGTTCCTGGCCAGATATGTATCCCTCCCAAACCAGAATAAGATCTGGACGGTGACTGTGAGCCCCGAGCAAAACGACCGCACCCCCTTGGTGATGGTGCATGGTTTTGGGGGCGGCGTGGGTCTCTGGATCCTCAACATGGACTCACTGAGTGCCCGCCGCACACTGCACACCTTCGATCTGCTTGGCTTCGGGCGAAGCTCAAGGCCAGCATTCCCAAGGGACCCGGAGGGGGCTGAGGATGAGTTTGTGACATCGATAGAGACATGGCGGGAGACCATGGGGATCCCCAGCATGATCCTCCTGGGGCACAGTTTGGGAGGATTCCTGGCCACTTCTTACTCAATCAAGTACCCTGATAGAGTTAAACACCTCATCCTGGTGGACCCATGGGGCTTTCCCCTCCGACCAACTAACCCCAGTGAGATCCGTGCACCCCCAGCCTGGGTCAAAGCCGTGGCATCTGTCCTAGGACGTTCCAATCCATTGGCTGTTCTTCGAGTAGCTGGGCCCTGGGGGCCTGGTCTGGTGCAGCGATTCCGGCCGGACTTCAAACGCAAGTTTGCAGACTTCTTTGAAGATGATACCATATCAGAGTATATTTACCACTGCAACGCACAGAATCCCAGTGGTGAGACAGCATTCAAAGCCATGATGGAGTCCTTTGGCTGGGCCCGGCGCCCTATGCTGGAGCGAATTCACTTGATTCGAAAAGATGTGCCTATCACTATGATCTACGGGTCCGACACCTGGATAGATACCAGTACGGGAAAAAAGGTGAAGATGCAGCGGCCGGATTCCTATGTCCGAGACATGGAGATTAAGGGTGCCTCCCACCATGTCTATGCTGACCAGCCACACATCTTCAATGCTGTGGTGGAGGAGATCTGCGACTCAGTTGATTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVDCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCATGGCCGATGATCTGGAGCAGCAGTCTCAAGGCTGGCTGAGTAGCTGGCTGCCCACGTGGCGCCCCACTTCCATGTCTCAGCTGAAGAATGTGGAAGCCAGGATCCTCCAGTGTCTCCAGAATAAGTTCCTGGCCAGATATGTATCCCTCCCAAACCAGAATAAGATCTGGACGGTGACTGTGAGCCCCGAGCAAAACGACCGCACCCCCTTGGTGATGGTGCATGGTTTTGGGGGCGGCGTGGGTCTCTGGATCCTCAACATGGACTCACTGAGTGCCCGCCGCACACTGCACACCTTCGATCTGCTTGGCTTCGGGCGAAGCTCAAGGCCAGCATTCCCAAGGGACCCGGAGGGGGCTGAGGATGAGTTTGTGACATCGATAGAGACATGGCGGGAGACCATGGGGATCCCCAGCATGATCCTCCTGGGGCACAGTTTGGGAGGATTCCTGGCCACTTCTTACTCAATCAAGTACCCTGATAGAGTTAAACACCTCATCCTGGTGGACCCATGGGGCTTTCCCCTCCGACCAACTAACCCCAGTGAGATCCGTGCACCCCCAGCCTGGGTCAAAGCCGTGGCATCTGTCCTAGGACGTTCCAATCCATTGGCTGTTCTTCGAGTAGCTGGGCCCTGGGGGCCTGGTCTGGTGCAGCGATTCCGGCCGGACTTCAAACGCAAGTTTGCAGACTTCTTTGAAGATGATACCATATCAGAGTATATTTACCACTGCAACGCACAGAATCCCAGTGGTGAGACAGCATTCAAAGCCATGATGGAGTCCTTTGGCTGGGCCCGGCGCCCTATGCTGGAGCGAATTCACTTGATTCGAAAGATGTGCCTATCACTATGATCTACGGGTCCGACACCTGGATAGATACCAGTACGGGAAAAAGGTGAAGATGCAGCGGCCGGATTCCTATGTCGAAACATGGAGATTAAGGGTGCCTCCCACCATTTCTATGCTGAACAGCCCACCATCTTCAATGGCTGGTGGGGGGAAGAGAATCTGCGCACCCAGTGATATGCCCACCTTCTGTGTACAAAGGTG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.17|D|6 Available