hGUHO03012

DGRC Stock Number: 1661794

RRID: RRID:DGRC_1661794

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03012

When publishing experiments using hGUHO03012, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03012 (DGRC Stock 1661794 ; https://dgrc.bio.indiana.edu//stock/1661794 ; RRID:DGRC_1661794)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene FAM50A   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG12259 FAM50A 14 Yes Yes
Base Vector pGW-HA.attB
AA Size 418
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGCTGGCACCATGGCTCAATACAAGGGCGCCGCGAGCGAGGCCGGCCGCGCCATGCACCTGATGAAGAAGCGGGAGAAGCAGCGCGAGCAGATGGAGCAGATGAAGCAGCGCATCGCGGAGGAGAACATCATGAAATCCAACATTGACAAGAAGTTCTCTGCGCACTACGACGCGGTGGAGGCAGAGCTCAAGTCCAGCACCGTGGGTCTCGTGACCCTGAATGACATGAAGGCCAAGCAGGAGGCTCTGGTGAAGGAGCGGGAGAAGCAGCTGGCCAAGAAGGAGCAGTCCAAGGAGCTGCAGATGAAGCTGGAGAAGCTTCGAGAGAAGGAGCGTAAGAAGGAAGCCAAGCGGAAGATCTCCAGCCTGTCCTTCACCCTGGAGGAGGAAGAAGAGGGAGGCGAGGAGGAAGAGGAGGCGGCCATGTATGAGGAGGAGATGGAAAGGGAAGAGATCACCACGAAGAAGAGAAAACTGGGGAAGAACCCAGACGTTGACACAAGCTTCTTGCCTGATCGAGACCGTGAGGAGGAGGAGAATCGGCTTCGGGAAGAGCTGCGGCAGGAGTGGGAAGCCAAGCAGGAGAAGATCAAGAGTGAGGAGATCGAGATCACCTTCAGCTACTGGGATGGCTCTGGGCACCGGCGGACAGTCAAGATGAGAAAGGGCAACACCATGCAGCAGTTCCTGCAGAAGGCGCTCGAGATCCTTCGGAAAGACTTCAGTGAGCTGAGGTCCGCAGGGGTGGAGCAGCTCATGTACATCAAGGAGGACTTGATCATCCCTCACCATCACAGCTTCTACGACTTCATCGTCACCAAGGCACGGGGGAAGAGTGGACCACTCTTCAACTTTGATGTTCATGACGATGTGCGGTTGCTCAGTGACGCCACTGTGGAGAAGGATGAGTCCCATGCAGGCAAGGTGGTGCTGAGGAGCTGGTACGAGAAGAACAAGCACATCTTTCCCGCCAGCCGCTGGGAACCCTACGACCCTGAAAAGAAGTGGGACAAGTACACGATCCGCGGCGACCCAGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIRGDPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TGGCACCATGGCTCAATACAAGGGCGCCGCGAGCGAGGCCGGCCGCGCCATGCACCTGATGAAGAAGCGGGAGAAGCAGCGCGAGCAGATGGAGCAGATGAAGCAGCGCATCGCGGAGGAGAACATCATGAAATCCAACATTGACAAGAAGTTCTCTGCGCACTACGACGCGGTGGAGGCAGAGCTCAAGTCCAGCACCGTGGGTCTCGTGACCCTGAATGACATGAAGGCCAAGCAGGAGGCTCTGGTGAAGGAGCGGGAGAAGCAGCTGGCCAAGAAGGAGCAGTCCAAGGAGCTGCAGATGAAGCTGGAGAAGCTTCGAGAGAAGGAGCGTAAGAAGGAAGCCAAGCGGAAGATCTCCAGCCTGTCCTTCACCCTGGAGGAGGAAGAAGAGGGAGGCGAGGAGGAAGAGGAGGCGGCCATGTATGAGGAGGAGATGGAAAGGGAAGAGATCACCACGAAGAAGAGAAAACTGGGGAAGAACCCAGACGTTGACACAAGCTTCTTGCCTGATCGAGACCGTGAGGAGGAGGAGAATCGGCTTCGGGAAGAGCTGCGGCAGGAGTGGGAAGCCAAGCAGGAGAAGATCAAGAGTGAGGAGATCGAGATCACCTTCAGCTACTGGGGATGGCTCTGGGCACCGGCGGACAGTCAAGATGAGAAAGGGCAACACCATGCAGCAGTTCCTGCAGAAAGGCGCTCGAGATCCTTCGGAAAGACTTCAGTGAGCTGAGGTCCGCAGGGGTGGAGCAGCTCATGTACATCAAGGGAGGACTTGATCATCCCTCACCATCACAGCTTCTACGACTTCATCGTCACAGGCACGGGGGGAAGGAGGTGACACTCTTCACTTGATGTTCATGACGATGTGCGGGTTGCT
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.17|C|10 Available