hGUHO03005

DGRC Stock Number: 1661792

RRID: RRID:DGRC_1661792

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03005

When publishing experiments using hGUHO03005, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03005 (DGRC Stock 1661792 ; https://dgrc.bio.indiana.edu//stock/1661792 ; RRID:DGRC_1661792)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene POU4F3   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
acj6 POU4F3 12 Yes Yes
Base Vector pGW-HA.attB
AA Size 416
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCACCATGATGGCCATGAACTCCAAGCAGCCTTTCGGCATGCACCCGGTGCTGCAAGAACCCAAATTCTCCAGTCTGCACTCTGGCTCCGAGGCTATGCGCCGAGTCTGTCTCCCAGCCCCGCAGCTGCAGGGTAATATATTTGGAAGCTTTGATGAGAGCCTGCTGGCACGCGCCGAAGCTCTGGCGGCGGTGGATATCGTCTCCCACGGCAAGAACCATCCGTTCAAGCCCGACGCCACCTACCATACCATGAGCAGCGTGCCCTGCACGTCCACTTCGTCCACCGTGCCCATCTCCCACCCAGCTGCGCTCACCTCACACCCTCACCACGCCGTGCACCAGGGCCTCGAAGGCGACCTGCTGGAGCACATCTCGCCCACGCTGAGTGTGAGCGGCCTGGGCGCTCCGGAACACTCGGTGATGCCCGCACAGATCCATCCACACCACCTGGGCGCCATGGGCCACCTGCACCAGGCCATGGGCATGAGTCACCCGCACACCGTGGCCCCTCATAGCGCCATGCCTGCATGCCTCAGCGACGTGGAGTCAGACCCGCGCGAGCTGGAAGCCTTCGCCGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGGGTGACCCAGGCGGACGTGGGCGCGGCTCTGGCTAATCTCAAGATCCCCGGCGTGGGCTCGCTGAGCCAAAGCACCATCTGCAGGTTCGAGTCTCTCACTCTCTCGCACAACAACATGATCGCTCTCAAGCCGGTGCTCCAGGCCTGGTTGGAGGAGGCCGAGGCCGCCTACCGAGAGAAGAACAGCAAGCCAGAGCTCTTCAACGGCAGCGAACGGAAGCGCAAACGCACGTCCATCGCGGCGCCGGAGAAGCGTTCACTCGAGGCCTATTTCGCTATCCAGCCACGTCCTTCATCTGAGAAGATCGCGGCCATCGCTGAGAAACTGGACCTTAAAAAGAACGTGGTGAGAGTCTGGTTCTGCAACCAGAGACAGAAACAGAAACGAATGAAGTATTCGGCTGTCCACTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVHLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCACCATGATGGCCATGAACTCCAAGCAGCCTTTCGGCATGCACCCGGTGCTGCAAGAACCCAAATTCTCCAGTCTGCACTCTGGCTCCGAGGCTATGCGCCGAGTCTGTCTCCCAGCCCCGCAGCTGCAGGGTAATATATTTGGAAGCTTTGATGAGAGCCTGCTGGCACGCGCCGAAGCTCTGGCGGCGGTGGATATCGTCTCCCACGGCAAGAACCATCCGTTCAAGCCCGACGCCACCTACCATACCATGAGCAGCGTGCCCTGCACGTCCACTTCGTCCACCGTGCCCATCTCCCACCCAGCTGCGCTCACCTCACACCCTCACCACGCCGTGCACCAGGGCCTCGAAGGCGACCTGCTGGAGCACATCTCGCCCACGCTGAGTGTGAGCGGCCTGGGCGCTCCGGAACACTCGGTGATGCCCGCACAGATCCATCCACACCACCTGGGCGCCATGGGCCACCTGCACCAGGCCATGGGCATGAGTCACCCGCACACCGTGGCCCCTCATAGCGCCATGCCTGCATGCCTCAGCGACGTGGAGTCAGACCCGCGCGAGCTGGAAGCCTTCGCCGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGGGTGACCCAGGCGGACGTGGGCGCGGCTCTGGCTAATCTCAAGATCCCCGGCGTGGGCTCGCTGAGCCAAAGCACCATCTGCAGGTTCGAGTCTCTCACTCTCTCGCACAACAACATGATCGCTCTCAAGCCGGTGCTCCAGGCCTGGTTGGAGGAGGCCGAGGCCGCCTACCGAGAGAAGAACAGCAAGCCAGAGCTCTTCAACGGCAGCGAACGGAAGCGCAAACGCACGTCCATCGCGCGCCGGAGAAGCGTTCACTCGAGGCCTATTTCCCTATCCAGCCCGTCCTTCATCTGAAAAAGATCGCGGTCCATCGCTGAAAAACTGGACCTTAAAAGAACGTGGTGGAGAGTCTAGTCTGCACCAAAAACAGAACCGAACGATGAGATCGCTGTCCACTTGCCACTTCCTGGGACAAGGTGGTACCTCGAA
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.17|C|8 Available