hGUHO03002

DGRC Stock Number: 1661790

RRID: RRID:DGRC_1661790

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO03002

When publishing experiments using hGUHO03002, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO03002 (DGRC Stock 1661790 ; https://dgrc.bio.indiana.edu//stock/1661790 ; RRID:DGRC_1661790)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene ZDHHC15   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG17287 ZDHHC15 10 Yes No
CG1407 ZDHHC15 12 No Yes
Base Vector pGW-HA.attB
AA Size 415
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCACCATGCGGCGAGGCTGGAAGATGGCTCTGTCTGGGGGGCTGCGGTGCTGCCGCCGGGTACTGTCCTGGGTGCCAGTGCTCGTTATTGTCCTCGTCGTGCTCTGGTCCTACTATGCCTACGTCTTTGAACTCTGCCTGGTGACTGTTTTGAGCCCAGCAGAAAAAGTTATTTACCTCATACTCTACCATGCCATCTTTGTGTTCTTTACCTGGACCTACTGGAAGTCTATCTTTACACTCCCACAGCAGCCAAACCAGAAGTTCCACTTGTCCTACACAGACAAGGAGCGCTATGAAAATGAAGAAAGACCTGAGGTCCAGAAGCAGATGCTTGTTGATATGGCCAAAAAGCTACCGGTTTACACAAGAACTGGAAGTGGAGCTGTACGATTCTGTGACCGGTGTCATCTGATCAAGCCAGACCGCTGCCACCACTGCTCTGTCTGTGCTATGTGTGTGTTAAAAATGGATCATCACTGCCCTTGGGTTAATAACTGCATTGGATTTTCCAACTACAAATTCTTCCTTCAATTCTTAGCTTACTCTGTTCTCTACTGCCTGTACATTGCTACGACAGTCTTCAGCTATTTCATCAAATACTGGAGAGGGGAATTACCCAGTGTTCGCTCTAAGTTCCATGTCCTTTTTCTTCTCTTTGTGGCCTGCATGTTTTTTGTCAGCCTTGTGATTCTCTTTGGTTACCATTGTTGGCTTGTCAGCAGAAACAAAACCACCTTAGAGGCCTTCTGCACTCCAGTGTTTACAAGTGGCCCAGAGAAAAATGGGTTCAACCTTGGCTTCATCAAGAATATCCAGCAGGTGTTTGGAGATAAGAAGAAGTTCTGGTTAATACCTATTGGTTCCAGCCCTGGTGATGGACACTCCTTCCCTATGAGGTCTATGAATGAGTCACAGAACCCACTGCTAGCAAATGAAGAAACCTGGGAAGACAACGAGGATGACAACCAAGATTATCCAGAAGGCTCATCATCTCTTGCTGTGGAAACGGAAACATTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETETLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Sequenced 5' End TTGGCACCATGCGGCGAGGCTGGAAGATGGCTCTGTCTGGGGGGCTGCGGTGCTGCCGCCGGGTACTGTCCTGGGTGCCAGTGCTCGTTATTGTCCTCGTCGTGCTCTGGTCCTACTATGCCTACGTCTTTGAACTCTGCCTGGTGACTGTTTTGAGCCCAGCAGAAAAAGTTATTTACCTCATACTCTACCATGCCATCTTTGTGTTCTTTACCTGGACCTACTGGAAGTCTATCTTTACACTCCCACAGCAGCCAAACCAGAAGTTCCACTTGTCCTACACAGACAAGGAGCGCTATGAAAATGAAGAAAGACCTGAGGTCCAGAAGCAGATGCTTGTTGATATGGCCAAAAAGCTACCGGTTTACACAAGAACTGGAAGTGGAGCTGTACGATTCTGTGACCGGTGTCATCTGATCAAGCCAGACCGCTGCCACCACTGCTCTGTCTGTGCTATGTGTGTGTTAAAAATGGATCATCACTGCCCTTGGGTTAATAACTGCATTGGATTTTCCAACTACAAATTCTTCCTTCAATTCTTAGCTTACTCTGTTCTCTACTGCCTGTACATTGCTACGACAGTCTTCAGCTATTTCATCAAATACTGGAGAGGGGAATTACCCAGTGTTCGCTCTAAGTTCCATGTCCTTTTTCTTCTCTTTGTGGCCTGCATGTTTTTTGTCAGCCTTGTGATTCTCTTTGGTTACCATTGTTGGCTTGTCAGCAGAAACAAAACCACCTTAGAGGCTTCTGCACTCCAGTGTTTACAAGTGGCCCAGAGAAAATGGGTTCAACCTTGGCTTCATCAAGATATCCAGCAGTGTTTGGAGATAGAAGAGTTCTGGTTAATACTATTGGTTCAGCCCTGGTGATGGACACTCCTCCCTATGAGGTCTATGATGAGTCACAGACCCACTGCTAGCAAATGAAGAAACCTGGGAAGACAACGAGGATGACACCAAGATTATCAGAAGGCTCATCAATCTTCTTGGCTGTGGAAACG
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.17|C|6 Available