hGUHO02429

DGRC Stock Number: 1661675

RRID: RRID:DGRC_1661675

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO02429

When publishing experiments using hGUHO02429, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO02429 (DGRC Stock 1661675 ; https://dgrc.bio.indiana.edu//stock/1661675 ; RRID:DGRC_1661675)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene PHF20L1   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
MBD-R2 PHF20L1 11 Yes Yes
Base Vector pGW-HA.attB
AA Size 363
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGAGTAAAAAGCCCCCAAATCGCCCTGGAATCACTTTTGAGATTGGTGCTCGTTTGGAGGCACTGGACTACTTACAAAAATGGTATCCATCACGAATTGAAAAAATTGACTATGAGGAGGGCAAGATGTTGGTCCATTTTGAGCGCTGGAGTCATCGTTATGATGAGTGGATTTACTGGGATAGCAATAGATTGCGACCCCTTGAGAGACCAGCACTAAGAAAAGAAGGGCTAAAAGATGAGGAAGATTTCTTTGATTTTAAAGCTGGAGAAGAAGTTCTGGCTCGTTGGACAGACTGTCGCTATTACCCTGCCAAGATTGAAGCAATTAACAAAGAAGGAACATTTACAGTTCAGTTTTATGATGGAGTAATTCGTTGTTTAAAAAGAATGCACATTAAAGCCATGCCCGAGGATGCTAAGGGGCAGGATTGGATAGCTTTAGTCAAAGCAGCTGCTGCAGCTGCAGCCAAGAACAAAACAGGGAGTAAACCTCGAACCAGCGCTAACAGCAATAAAGATAAGGATAAAGATGAGAGAAAGTGGTTTAAAGTACCTTCAAAGAAGGAGGAAACTTCAACTTGTATAGCCACACCAGACGTAGAGAAGAAGGAAGATCTGCCTACATCTAGTGAAACATTTGGACTTCATGTAGAGAACGTTCCAAAGATGGTCTTTCCACAGCCAGAGAGCACATTATCAAACAAGAGGAAAAATAATCAAGGCAACTCGTTTCAGGCAAAGAGAGCTCGACTTAACAAGATTACTGGTTTGTTGGCATCCAAAGCTGTTGGGGTTGATGGTGCTGAAAAAAAGGAAGACTACAATGAAACAGCTCCAATGCTGGAGCAGGTATGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDEEDFFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVKAAAAAAAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNKITGLLASKAVGVDGAEKKEDYNETAPMLEQVCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.16|A|11 Available