hGUHO01816

DGRC Stock Number: 1661473

RRID: RRID:DGRC_1661473

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO01816

When publishing experiments using hGUHO01816, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO01816 (DGRC Stock 1661473 ; https://dgrc.bio.indiana.edu//stock/1661473 ; RRID:DGRC_1661473)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene RAB27B   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
Rab27 RAB27B 10 No Yes
Base Vector pGW-HA.attB
AA Size 296
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGACCGATGGAGACTATGATTATCTGATCAAACTCCTGGCCCTCGGGGATTCAGGGGTGGGGAAGACAACATTTCTTTATAGATACACAGATAATAAATTCAATCCCAAATTCATCACTACAGTAGGAATAGACTTTCGGGAAAAACGTGTGGTTTATAATGCACAAGGACCGAATGGATCTTCAGGGAAAGCATTTAAAGTGCATCTTCAGCTTTGGGACACTGCGGGACAAGAGCGGTTCCGGAGTCTCACCACTGCATTTTTCAGAGACGCCATGGGCTTCTTATTAATGTTTGACCTCACCAGTCAACAGAGCTTCTTAAATGTCAGAAACTGGATGAGCCAACTGCAAGCAAATGCTTATTGTGAAAATCCAGATATAGTATTAATTGGCAACAAGGCAGACCTACCAGATCAGAGGGAAGTCAATGAACGGCAAGCTCGGGAACTGGCTGACAAATATGGCATACCATATTTTGAAACAAGTGCAGCAACTGGACAGAATGTGGAGAAAGCTGTAGAAACCCTTTTGGACTTAATCATGAAGCGAATGGAACAGTGTGTGGAGAAGACACAAATCCCTGATACTGTCAATGGTGGAAATTCTGGAAACTTGGATGGGGAAAAGCCACCAGAGAAGAAATGTATCTGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCICYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.14|A|1 Available