hGUHO01617

DGRC Stock Number: 1661398

RRID: RRID:DGRC_1661398

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO01617

When publishing experiments using hGUHO01617, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO01617 (DGRC Stock 1661398 ; https://dgrc.bio.indiana.edu//stock/1661398 ; RRID:DGRC_1661398)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene LYZL2   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG16756 LYZL2 8 Yes No
CG11159 LYZL2 9 Yes No
CG16799 LYZL2 10 No Yes
Base Vector pGW-HA.attB
AA Size 272
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGCAGGACGCTCCCCTGAGCTGCCTGTCACCGACTAAGTGGAGCAGTGTTTCTTCCGCAGACTCAACTGAGAAGTCAGCCTCTGCGGCAGGCACCAGGAATCTGCCTTTTCAGTTCTGTCTCCGGCAGGCTTTGAGGATGAAGGCTGCGGGCATTCTGACCCTCATTGGCTGCCTGGTCACAGGCGCCGAGTCCAAAATCTACACTCGTTGCAAACTGGCAAAAATATTCTCGAGGGCTGGCCTGGACAATTACTGGGGCTTCAGCCTTGGAAACTGGATCTGCATGGCGTATTATGAGAGCGGCTACAACACCACAGCCCAGACGGTCCTGGATGACGGCAGCATCGACTACGGCATCTTCCAGATCAACAGCTTCGCGTGGTGCAGACGCGGAAAGCTGAAGGAGAACAACCACTGCCACGTCGCCTGCTCAGCCTTGGTCACTGATGACCTCACAGATGCGATTATCTGTGCCAAGAAAATTGTTAAAGAGACACAAGGAATGAATTATTGGCAAGGCTGGAAGAAACACTGTGAGGGGAGAGACCTGTCCGACTGGAAAAAAGACTGTGAGGTTTCCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVSYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.13|B|10 Available