hGUHO01547

DGRC Stock Number: 1661382

RRID: RRID:DGRC_1661382

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO01547

When publishing experiments using hGUHO01547, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO01547 (DGRC Stock 1661382 ; https://dgrc.bio.indiana.edu//stock/1661382 ; RRID:DGRC_1661382)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene TIMM17B   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
Tim17b TIMM17B 15 Yes Yes
CG1724 TIMM17B 11 Yes No
Tim17b1 TIMM17B 9 Yes No
Tim17a2 TIMM17B 8 Yes No
Tim17a1 TIMM17B 9 Yes No
Tim17b2 TIMM17B 11 Yes No
Base Vector pGW-HA.attB
AA Size 250
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGGAGGAGTACGCTCGGGAGCCCTGCCCATGGCGAATTGTGGATGATTGCGGTGGAGCCTTCACTATGGGTGTCATCGGTGGCGGAGTCTTCCAGGCCATCAAGGGTTTCCGCAATGCCCCTGTTGGAATTCGGCACCGGTTGAGAGGTAGTGCCAATGCTGTGAGGATCCGAGCCCCCCAGATTGGAGGTAGCTTCGCAGTGTGGGGGGGCCTGTTCTCCACCATTGACTGTGGCCTGGTGCGGCTTCGGGGCAAGGAGGATCCCTGGAACTCTATCACCAGTGGAGCATTGACCGGGGCTGTGCTGGCTGCCCGCAGTGGCCCACTGGCCATGGTGGGCTCAGCAATGATGGGGGGCATCCTGTTGGCCCTCATTGAGGGCGTTGGCATCCTCCTCACTCGCTACACAGCCCAGCAGTTCCGAAATGCGCCCCCATTCCTGGAGGACCCCAGCCAGCTGCCCCCTAAGGATGGCACCCCGGCCCCAGGCTACCCCAGCTATCAGCAGTACCACTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYHCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.13|A|6 Available