hGUHO01482

DGRC Stock Number: 1661356

RRID: RRID:DGRC_1661356

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO01482

When publishing experiments using hGUHO01482, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO01482 (DGRC Stock 1661356 ; https://dgrc.bio.indiana.edu//stock/1661356 ; RRID:DGRC_1661356)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene CBX1   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
HP1b CBX1 12 Yes Yes
Su(var)205 CBX1 9 Yes No
HP1e CBX1 6 Yes No
Base Vector pGW-HA.attB
AA Size 264
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGCAGGCTCCACCATGGGGAAAAAACAAAACAAGAAGAAAGTGGAGGAGGTGCTAGAAGAGGAGGAAGAGGAATATGTGGTGGAAAAAGTTCTCGACCGTCGAGTGGTAAAGGGCAAAGTGGAGTACCTCCTAAAGTGGAAGGGATTCTCAGATGAGGACAACACATGGGAGCCAGAAGAGAACCTGGATTGCCCCGACCTCATTGCTGAGTTTCTGCAGTCACAGAAAACAGCACATGAGACAGATAAATCAGAGGGAGGCAAGCGCAAAGCTGATTCTGATTCTGAAGATAAGGGAGAGGAGAGCAAACCAAAGAAGAAGAAAGAAGAGTCAGAAAAGCCACGAGGCTTTGCTCGAGGTTTGGAGCCGGAGCGGATTATTGGAGCTACAGACTCCAGTGGAGAGCTCATGTTCCTGATGAAATGGAAAAACTCTGATGAGGCTGACCTGGTCCCTGCCAAGGAAGCCAATGTCAAGTGCCCACAGGTTGTCATATCCTTCTATGAGGAAAGGCTGACGTGGCATTCCTACCCCTCGGAGGATGATGACAAAAAAGATGACAAGAACTTGGACCCAGCTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKNLDPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.12|G|4 Available