hGUHO01414

DGRC Stock Number: 1661315

RRID: RRID:DGRC_1661315

Donor: BDGP

Ships via United States Priority Mail

This clone has been verified by BDGP. The ORF, including the tag, has been fully sequenced and the sequence is available below.



No Image Available


Price: $46.00

You must to begin shopping. If have not yet setup a UserID and Lab Account, you should do that now.

To cite hGUHO01414

When publishing experiments using hGUHO01414, please include the following details in your manuscript.

  • Materials and Methods
    hGUHO01414 (DGRC Stock 1661315 ; https://dgrc.bio.indiana.edu//stock/1661315 ; RRID:DGRC_1661315)
  • Acknowledgements
    • Drosophila Genomics Resource Center (NIH Grant 2P40OD010949)
Species Homo sapiens
Collections Human ORF
Human Gene CCDC28A   ( Entrez , HGNC )
Orthology
FlyHumanDIOPT ScoreDIOPT RankBest HitBest Reverse Hit
CG10874 CCDC28A 11 Yes Yes
Base Vector pGW-HA.attB
AA Size 240
Tag Info 3xHA
Verified Nucleotide Sequence CAAGTTTGTACAAAAAAGTTGGCATGCCAAAAAAAAATGCCATTCCAGTGAGTAAAAGCACAGGGTTTTCAAATCCTGCATCACAGTCAACTTCACAGCGACCAAAGTTAAAAAGAGTGATGAAAGAAAAGACCAAACCTCAGGGTGGAGAGGGCAAAGGCGCTCAGTCAACTCCGATCCAGCACTCCTTCCTCACTGATGTCTCAGATGTTCAGGAGATGGAGAGAGGGCTGCTCAGTCTTTTGAATGATTTCCACTCTGGAAAACTTCAAGCATTTGGAAATGAATGTTCCATTGAACAGATGGAACATGTTCGGGGAATGCAGGAGAAATTAGCTCGCTTGAATTTGGAGCTCTATGGGGAGTTAGAGGAACTTCCTGAGGATAAGAGAAAAACAGCCAGTGACTCCAATCTGGATAGGCTTCTGTCAGATTTAGAAGAATTGAATTCTTCCATACAAAAACTCCATTTGGCAGATGCACAAGATGTTCCAAATACTTCTGCTAGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
AA Sequence MPKKNAIPVSKSTGFSNPASQSTSQRPKLKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSASYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*
Collection Well Status Note
Human ORF HumanORF hGUHO-RA.12|C|11 Available